PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016464050.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family SRS
Protein Properties Length: 351aa    MW: 38097.8 Da    PI: 8.3292
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016464050.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF702226.16.8e-701272803153
          DUF702   3 sgtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasa......aeaaskrkrelkskkqsalsstkl 91 
                     +g+++CqdCGnqakkdC h RCRtCCksrgf+C+thvkstWvpaakrrerqqqlaa+++++++++      +++++  +++l+++++s+l++t+l
  XP_016464050.1 127 VGGMNCQDCGNQAKKDCPHLRCRTCCKSRGFQCQTHVKSTWVPAAKRRERQQQLAALQQHNQQQQtqqlslRADSNIIPKRLRENTSSSLACTRL 221
                     7899*****************************************************99998888555665555555556667888889999998 PP

          DUF702  92 ssaeskkeletsslPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGle 153
                     +  +s+      ++P+evss+avfrcv+vs++dd+e+++aYqtav+igGh+fkGiLydqG+e
  XP_016464050.1 222 PAISSE---VGGHFPAEVSSQAVFRCVKVSAIDDAEDQFAYQTAVNIGGHLFKGILYDQGPE 280
                     888765...5677***********************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051427.8E-68129280IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016231.3E-26131173IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016244.8E-28231279IPR006511Lateral Root Primordium type 1, C-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 351 aa     Download sequence    Send to blast
MSGFFTLGGG GGGGNKEQQQ QQEQDQLATN SFLLFKNEEI YNKGFELWQQ YYQLHQQRAQ  60
TPQHQVQEMD FSVGVGPSNN RRIISGSSSS SGNNNIVGDD NNNNNNHNYS NSFRVMRATG  120
GSSSSGVGGM NCQDCGNQAK KDCPHLRCRT CCKSRGFQCQ THVKSTWVPA AKRRERQQQL  180
AALQQHNQQQ QTQQLSLRAD SNIIPKRLRE NTSSSLACTR LPAISSEVGG HFPAEVSSQA  240
VFRCVKVSAI DDAEDQFAYQ TAVNIGGHLF KGILYDQGPE GRYSGGGGES SSGSAAAQQA  300
LNFITGATTS TTAAAATSHQ QQHGTMFDPS VYPTPINAFM AGTQFFPPPR P
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4110328e-41AM411032.1 Trifolium pratense AFLP fragment rc0085.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016464050.10.0PREDICTED: protein SHI RELATED SEQUENCE 1-like isoform X2
TrEMBLK4BVH61e-146K4BVH6_SOLLC; Uncharacterized protein
STRINGSolyc04g080970.2.11e-146(Solanum lycopersicum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G51060.13e-61Lateral root primordium (LRP) protein-related